SCOPe 2.08: Domain d3zi7a1: 3zi7 A:803-1077

Lineage for d3zi7a1 (3zi7 A:803-1077)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein automated matches [190097] (2 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1094188] [193157] (1 PDB entry)

8. Domain d3zi7a1: 3zi7 A:803-1077 [193158]
   Other proteins in same PDB: d3zi7a2, d3zi7b1, d3zi7b2
   automated match to d1gkka_
   complexed with cd

Details for d3zi7a1

PDB Entry: 3zi7, 2.3 Å

PDB Description: structure of fae solved by sad from data collected by direct data collection (ddc) using the grob robot goniometer

PDB Compounds: (A:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d3zi7a1:

Sequence; same for both SEQRES and ATOM records:

>d3zi7a1 c.69.1.2 (A:803-1077) automated matches {Clostridium thermocellum [TaxId: 1094188]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhe

Timeline for d3zi7a1:

• d3zi7a1 first appeared in SCOPe 2.02, called d3zi7a_
  
• d3zi7a1 appears in SCOPe 2.07