SCOPe 2.05: Domain d3uf9a_: 3uf9 A:

Lineage for d3uf9a_ (3uf9 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (22 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [188418] (10 PDB entries)

8. Domain d3uf9a_: 3uf9 A: [193156]
   automated match to d2vc7a_
   complexed with co, fe2, fst, gol

Details for d3uf9a_

PDB Entry: 3uf9, 2.68 Å

PDB Description: Crystal structure of SsoPox in complex with the phosphotriester fensulfothion

PDB Compounds: (A:) aryldialkylphosphatase

SCOPe Domain Sequences for d3uf9a_:

Sequence; same for both SEQRES and ATOM records:

>d3uf9a_ c.1.9.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdycctidwgtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs

Timeline for d3uf9a_:

• d3uf9a_ first appeared in SCOPe 2.02
  
• d3uf9a_ appears in SCOPe 2.04
  
• d3uf9a_ appears in SCOPe 2.06
  
• d3uf9a_ appears in the current release, SCOPe 2.08