Lineage for d4kmsa1 (4kms A:1-239)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095869Species Rickettsia felis [TaxId:315456] [193153] (1 PDB entry)
  8. 2095870Domain d4kmsa1: 4kms A:1-239 [193154]
    Other proteins in same PDB: d4kmsa2, d4kmsb2
    automated match to d3ezla_

Details for d4kmsa1

PDB Entry: 4kms (more details), 2 Å

PDB Description: Crystal structure of Acetoacetyl-CoA reductase from Rickettsia felis
PDB Compounds: (A:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d4kmsa1:

Sequence, based on SEQRES records: (download)

>d4kmsa1 c.2.1.0 (A:1-239) automated matches {Rickettsia felis [TaxId: 315456]}
mseiaivtggtrgigkatalelknkgltvvanffsnydaakemeekygiktkcwnvadfe
ecrqavkeieeefkkpvsilvnnagitkdkmlhrmshqdwndvinvnlnscfnmsssvme
qmrnqdygrivnissinaqagqvgqtnysaakagiigftkalaretasknitvnciapgy
iatemvgavpedvlakiinsipkkrlgqpeeiaravaflvdenagfitgetisingghn

Sequence, based on observed residues (ATOM records): (download)

>d4kmsa1 c.2.1.0 (A:1-239) automated matches {Rickettsia felis [TaxId: 315456]}
mseiaivtggtrgigkatalelknkgltvvanffsnydaakemeekygiktkcwnvadfe
ecrqavkeieeefkkpvsilvnnagitkdkmlhrmshqdwndvinvnlnscfnmsssvme
qmrnqdygrivnissinaqvgqtnysaakagiigftkalaretasknitvnciapgyiat
emvpedvlakiinsipkkrlgqpeeiaravaflvdenagfitgetisingghn

SCOPe Domain Coordinates for d4kmsa1:

Click to download the PDB-style file with coordinates for d4kmsa1.
(The format of our PDB-style files is described here.)

Timeline for d4kmsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kmsa2