Lineage for d4kjha_ (4kjh A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441678Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1441679Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1441680Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1441822Protein automated matches [190420] (8 species)
    not a true protein
  7. 1441838Species Momordica balsamina [TaxId:3672] [189375] (54 PDB entries)
  8. 1441874Domain d4kjha_: 4kjh A: [193152]
    automated match to d3s9qa_
    complexed with cyt, gol, nag

Details for d4kjha_

PDB Entry: 4kjh (more details), 1.98 Å

PDB Description: crystal structure of the complex of ribosome inactivating protein from momordica balsamina with cytosine at 1.98 a resolution
PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4kjha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjha_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d4kjha_:

Click to download the PDB-style file with coordinates for d4kjha_.
(The format of our PDB-style files is described here.)

Timeline for d4kjha_: