Lineage for d4k64a1 (4k64 A:5-324)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385289Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)
  8. 2385368Domain d4k64a1: 4k64 A:5-324 [193147]
    Other proteins in same PDB: d4k64a2, d4k64b_, d4k64c2, d4k64d_, d4k64e2, d4k64f_, d4k64g2, d4k64h_
    automated match to d2fk0a1
    complexed with nag

Details for d4k64a1

PDB Entry: 4k64 (more details), 2.6 Å

PDB Description: structure of an avian influenza h5 hemagglutinin from the influenza virus complexed with human receptor analog lstc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4k64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k64a1 b.19.1.2 (A:5-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipks
swsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgihh
pndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d4k64a1:

Click to download the PDB-style file with coordinates for d4k64a1.
(The format of our PDB-style files is described here.)

Timeline for d4k64a1: