Lineage for d4k64a_ (4k64 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778247Domain d4k64a_: 4k64 A: [193147]
    Other proteins in same PDB: d4k64b_, d4k64d_, d4k64f_, d4k64h_
    automated match to d2fk0a1
    complexed with nag

Details for d4k64a_

PDB Entry: 4k64 (more details), 2.6 Å

PDB Description: structure of an avian influenza h5 hemagglutinin from the influenza virus complexed with human receptor analog lstc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4k64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k64a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipk
sswsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgih
hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d4k64a_:

Click to download the PDB-style file with coordinates for d4k64a_.
(The format of our PDB-style files is described here.)

Timeline for d4k64a_: