SCOPe 2.08: Domain d4jvfb_: 4jvf B:

Lineage for d4jvfb_ (4jvf B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein GMP-PDE delta [74846] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries)

8. Domain d4jvfb_: 4jvf B: [193133]
   automated match to d1kshb_
   complexed with 17x

Details for d4jvfb_

PDB Entry: 4jvf, 2.4 Å

PDB Description: the crystal structure of pde6d in complex with the inhibitor (s)-5

PDB Compounds: (B:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d4jvfb_:

Sequence, based on SEQRES records:

>d4jvfb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
kderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsrel
nfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpasvl
tgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records):

>d4jvfb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
kderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsrel
nfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieampasvltgnvii
etkffdddllvstsrvrlfyv

Timeline for d4jvfb_:

• d4jvfb_ first appeared in SCOPe 2.02
  
• d4jvfb_ appears in SCOPe 2.07