Lineage for d1fm9d_ (1fm9 D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747550Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 1747551Species Human (Homo sapiens) [TaxId:9606] [48525] (94 PDB entries)
    Uniprot P37231 232-505
  8. 1747602Domain d1fm9d_: 1fm9 D: [19313]
    Other proteins in same PDB: d1fm9a_
    complexed with 570, 9cr

Details for d1fm9d_

PDB Entry: 1fm9 (more details), 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and gi262570 and co-activator peptides.
PDB Compounds: (D:) Peroxisome proliferator activated receptor gamma

SCOPe Domain Sequences for d1fm9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm9d_ a.123.1.1 (D:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d1fm9d_:

Click to download the PDB-style file with coordinates for d1fm9d_.
(The format of our PDB-style files is described here.)

Timeline for d1fm9d_: