Lineage for d4jr1a1 (4jr1 A:57-302)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2100992Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2101043Protein Caspase-7 [63961] (1 species)
  7. 2101044Species Human (Homo sapiens) [TaxId:9606] [63962] (12 PDB entries)
    Uniprot P55210 57-303
  8. 2101047Domain d4jr1a1: 4jr1 A:57-302 [193125]
    Other proteins in same PDB: d4jr1a2, d4jr1b2
    automated match to d1i4oa_
    complexed with cl

Details for d4jr1a1

PDB Entry: 4jr1 (more details), 2.15 Å

PDB Description: human procaspase-7 bound to ac-devd-cmk
PDB Compounds: (A:) procaspase-7

SCOPe Domain Sequences for d4jr1a1:

Sequence, based on SEQRES records: (download)

>d4jr1a1 c.17.1.1 (A:57-302) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrcktlle
kpklffiqacrgtelddgiqaasgpindtdanprykipveadflfaystvpgyyswrspg
rgswfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekkqipcvvsmlt
kelyfs

Sequence, based on observed residues (ATOM records): (download)

>d4jr1a1 c.17.1.1 (A:57-302) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
tyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgfdvivyndcsc
akmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahfrgdrcktlle
kpklffiqacrgtindtdanprykipveadflfaystvpgyyswrspgrgswfvqalcsi
leehgkdleimqiltrvndrvarhfkqipcvvsmltkelyfs

SCOPe Domain Coordinates for d4jr1a1:

Click to download the PDB-style file with coordinates for d4jr1a1.
(The format of our PDB-style files is described here.)

Timeline for d4jr1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jr1a2