SCOPe 2.05: Domain d4jaja_: 4jaj A:

Lineage for d4jaja_ (4jaj A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
   OPK group; AIRK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [90039] (46 PDB entries)

8. Domain d4jaja_: 4jaj A: [193120]
   automated match to d3fdna_
   complexed with xu1

Details for d4jaja_

PDB Entry: 4jaj, 2.7 Å

PDB Description: crystal structure of aurora kinase a in complex with benzo[c][1,8]naphthyridin-6(5h)-one

PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d4jaja_:

Sequence; same for both SEQRES and ATOM records:

>d4jaja_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
khnpsqrpmlrevlehpwitanssk

Timeline for d4jaja_:

• d4jaja_ first appeared in SCOPe 2.02
  
• d4jaja_ appears in SCOPe 2.04
  
• d4jaja_ appears in SCOPe 2.06
  
• d4jaja_ appears in the current release, SCOPe 2.08