Lineage for d2prgb_ (2prg B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 50845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 50846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (14 proteins)
  6. 50877Protein Peroxisome proliferator activated receptor gamma, PPAR-RXR [48524] (1 species)
  7. 50878Species Human (Homo sapiens) [TaxId:9606] [48525] (6 PDB entries)
  8. 50880Domain d2prgb_: 2prg B: [19312]
    Other proteins in same PDB: d2prgc_

Details for d2prgb_

PDB Entry: 2prg (more details), 2.3 Å

PDB Description: ligand-binding domain of the human peroxisome proliferator activated receptor gamma

SCOP Domain Sequences for d2prgb_:

Sequence, based on SEQRES records: (download)

>d2prgb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-RXR {Human (Homo sapiens)}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d2prgb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-RXR {Human (Homo sapiens)}
esadlralakhlydsyiksfpltkakarailtviydmnslmqskevairifqgcqfrsve
avqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtre
flkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqd
nllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqe
iykdly

SCOP Domain Coordinates for d2prgb_:

Click to download the PDB-style file with coordinates for d2prgb_.
(The format of our PDB-style files is described here.)

Timeline for d2prgb_: