Lineage for d2prga_ (2prg A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6345Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 6346Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 6347Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins)
  6. 6372Protein Peroxisome proliferator activated receptor gamma, PPAR-RXR [48524] (1 species)
  7. 6373Species Human (Homo sapiens) [TaxId:9606] [48525] (6 PDB entries)
  8. 6374Domain d2prga_: 2prg A: [19311]
    Other proteins in same PDB: d2prgc_

Details for d2prga_

PDB Entry: 2prg (more details), 2.3 Å

PDB Description: ligand-binding domain of the human peroxisome proliferator activated receptor gamma

SCOP Domain Sequences for d2prga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prga_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-RXR {Human (Homo sapiens)}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

SCOP Domain Coordinates for d2prga_:

Click to download the PDB-style file with coordinates for d2prga_.
(The format of our PDB-style files is described here.)

Timeline for d2prga_: