Lineage for d1qkna_ (1qkn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008714Protein Estrogen receptor beta [48521] (2 species)
  7. 2008766Species Norway rat (Rattus norvegicus) [TaxId:10116] [48523] (2 PDB entries)
  8. 2008767Domain d1qkna_: 1qkn A: [19310]
    complex with antagonist raloxifene
    complexed with act, ral

Details for d1qkna_

PDB Entry: 1qkn (more details), 2.25 Å

PDB Description: rat oestrogen receptor beta ligand-binding domain in complex with antagonist raloxifene
PDB Compounds: (A:) Estrogen receptor beta

SCOPe Domain Sequences for d1qkna_:

Sequence, based on SEQRES records: (download)

>d1qkna_ a.123.1.1 (A:) Estrogen receptor beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfve
lslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmll
attsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavtdalvwvi
aksgissqqqsvrlanllmllshvrhisnkgmehllsmkcknvvpvydlllemlna

Sequence, based on observed residues (ATOM records): (download)

>d1qkna_ a.123.1.1 (A:) Estrogen receptor beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfve
lslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmll
attsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavtdalvwvi
aksgissqqqsvrlanllmllshvrhisnkgmehllsmkdlllemlna

SCOPe Domain Coordinates for d1qkna_:

Click to download the PDB-style file with coordinates for d1qkna_.
(The format of our PDB-style files is described here.)

Timeline for d1qkna_: