SCOPe 2.04: Domain d4in4a_: 4in4 A:

Lineage for d4in4a_ (4in4 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193097] (7 PDB entries)

8. Domain d4in4a_: 4in4 A: [193098]
   automated match to d1u6dx_
   complexed with 4id, po4

Details for d4in4a_

PDB Entry: 4in4, 2.59 Å

PDB Description: Crystal structure of cpd 15 bound to Keap1 Kelch domain

PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4in4a_:

Sequence; same for both SEQRES and ATOM records:

>d4in4a_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

Timeline for d4in4a_:

• d4in4a_ first appeared in SCOPe 2.02
  
• d4in4a_ appears in SCOPe 2.03
  
• d4in4a_ appears in SCOPe 2.05
  
• d4in4a_ appears in the current release, SCOPe 2.08