Lineage for d4in4a_ (4in4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808612Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2808613Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2808622Protein automated matches [190126] (2 species)
    not a true protein
  7. 2808623Species Human (Homo sapiens) [TaxId:9606] [193097] (24 PDB entries)
  8. 2808640Domain d4in4a_: 4in4 A: [193098]
    automated match to d1u6dx_
    complexed with 4id, po4

Details for d4in4a_

PDB Entry: 4in4 (more details), 2.59 Å

PDB Description: Crystal structure of cpd 15 bound to Keap1 Kelch domain
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4in4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4in4a_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d4in4a_:

Click to download the PDB-style file with coordinates for d4in4a_.
(The format of our PDB-style files is described here.)

Timeline for d4in4a_: