Lineage for d4inca_ (4inc A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401193Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 1401194Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 1401195Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 1401260Protein automated matches [191082] (2 species)
    not a true protein
  7. 1401266Species Human (Homo sapiens) [TaxId:9606] [189791] (3 PDB entries)
  8. 1401267Domain d4inca_: 4inc A: [193095]
    automated match to d3tw2a_
    complexed with cl

Details for d4inca_

PDB Entry: 4inc (more details), 1.19 Å

PDB Description: Human Histidine Triad Nucleotide Binding Protein 2
PDB Compounds: (A:) Histidine triad nucleotide-binding protein 2, mitochondrial

SCOPe Domain Sequences for d4inca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inca_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpadilyedqqclvfrdvapqapvhflvipkkpiprisqaeeedqqllghlllvakqta
kaeglgdgyrlvindgklgaqsvyhlhihvlggrqlqwppg

SCOPe Domain Coordinates for d4inca_:

Click to download the PDB-style file with coordinates for d4inca_.
(The format of our PDB-style files is described here.)

Timeline for d4inca_: