SCOPe 2.02: Domain d4inca_: 4inc A:

Lineage for d4inca_ (4inc A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein automated matches [191082] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189791] (5 PDB entries)

8. Domain d4inca_: 4inc A: [193095]
   automated match to d3tw2a_
   complexed with cl

Details for d4inca_

PDB Entry: 4inc, 1.19 Å

PDB Description: Human Histidine Triad Nucleotide Binding Protein 2

PDB Compounds: (A:) Histidine triad nucleotide-binding protein 2, mitochondrial

SCOPe Domain Sequences for d4inca_:

Sequence; same for both SEQRES and ATOM records:

>d4inca_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpadilyedqqclvfrdvapqapvhflvipkkpiprisqaeeedqqllghlllvakqta
kaeglgdgyrlvindgklgaqsvyhlhihvlggrqlqwppg

Timeline for d4inca_:

• d4inca_ is new in SCOPe 2.02-stable
  
• d4inca_ appears in SCOPe 2.03
  
• d4inca_ appears in the current release, SCOPe 2.08