Lineage for d4imna_ (4imn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805614Species Human (Homo sapiens) [TaxId:9606] [187833] (51 PDB entries)
  8. 2805641Domain d4imna_: 4imn A: [193094]
    automated match to d3bx8b_
    complexed with 1pg

Details for d4imna_

PDB Entry: 4imn (more details), 2.09 Å

PDB Description: Crystal structure of wild type human Lipocalin PGDS bound with PEG MME 2000
PDB Compounds: (A:) Lipocalin-type prostaglandin-D synthase

SCOPe Domain Sequences for d4imna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4imna_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svqpnfqqdkflgrwfsaglasnsswlrekkaalsmcksvvapatdgglnltstflrknq
cetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatl
ysrtqtpraelkekftafckaqgftedtivflpq

SCOPe Domain Coordinates for d4imna_:

Click to download the PDB-style file with coordinates for d4imna_.
(The format of our PDB-style files is described here.)

Timeline for d4imna_: