| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Streptococcus pyogenes [TaxId:198466] [193090] (2 PDB entries) |
| Domain d4i7hb_: 4i7h B: [193091] automated match to d2xigc_ complexed with ni, zn |
PDB Entry: 4i7h (more details), 2 Å
SCOPe Domain Sequences for d4i7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7hb_ a.4.5.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 198466]}
dihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpnm
slatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmdi
akeaheqtgykvtripviaygicpdcqa
Timeline for d4i7hb_: