Lineage for d4htwa_ (4htw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2718011Protein automated matches [190369] (8 species)
    not a true protein
  7. 2718056Species Simian immunodeficiency virus [TaxId:11723] [193087] (1 PDB entry)
  8. 2718057Domain d4htwa_: 4htw A: [193088]
    automated match to d2wlva_

Details for d4htwa_

PDB Entry: 4htw (more details), 2.9 Å

PDB Description: sivmac239 capsid n-terminal domain
PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d4htwa_:

Sequence, based on SEQRES records: (download)

>d4htwa_ a.73.1.1 (A:) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
pvqqiggnyvhlplsprtlnawvklieekkfgaevvpgfqalsegctpydinqmlncvgd
hqaamqiirdiineeaadwdlqhpqpapqqgqlrepsgsdiagttssvdeqiqwmyrqqn
pipvgniyrrwiqlglqkcvrmy

Sequence, based on observed residues (ATOM records): (download)

>d4htwa_ a.73.1.1 (A:) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
pvqqiggnyvhlplsprtlnawvklieekkfgaevvpgfqalsegctpydinqmlncvgd
hqaamqiirdiineeaadwdlqhpqpaqqgqlrepsgsdiagttssvdeqiqwmyrqqnp
ipvgniyrrwiqlglqkcvrmy

SCOPe Domain Coordinates for d4htwa_:

Click to download the PDB-style file with coordinates for d4htwa_.
(The format of our PDB-style files is described here.)

Timeline for d4htwa_: