Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
Protein automated matches [190277] (9 species) not a true protein |
Species Proteus mirabilis [TaxId:584] [193085] (2 PDB entries) |
Domain d4hs9a_: 4hs9 A: [193086] automated match to d1ex9a_ complexed with 1pe, ca, cl, gol, pe4; mutant |
PDB Entry: 4hs9 (more details), 1.8 Å
SCOPe Domain Sequences for d4hs9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hs9a_ c.69.1.18 (A:) automated matches {Proteus mirabilis [TaxId: 584]} mstkypivlvhglagfseivgfpyfygiadaltqdghqvftaslsafnsnevrgkqlwqf vqtilqetqtkkvnfighsqgplacryvaanypdsvasvtsingvnhgseiadlyrriir kdsipeyivekvlnafgtiistfsghrgdpqdaiaalesltteqvtefnnkypqalpktp cgegdeivngvhyycfgsyiqeliagengnlldpthaamrvlntlftekqndglvgrcsm rlgklikddyaqdhfdmvnqvaglvsynenivaiytlhakylaskql
Timeline for d4hs9a_: