Lineage for d4hjra_ (4hjr A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590101Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1590329Protein automated matches [190581] (8 species)
    not a true protein
  7. 1590348Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (8 PDB entries)
  8. 1590355Domain d4hjra_: 4hjr A: [193081]
    automated match to d2pxha_

Details for d4hjra_

PDB Entry: 4hjr (more details), 2.5 Å

PDB Description: Crystal structure of F2YRS
PDB Compounds: (A:) Tyrosine-tRNA ligase

SCOPe Domain Sequences for d4hjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hjra_ c.26.1.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
pirkrlleh

SCOPe Domain Coordinates for d4hjra_:

Click to download the PDB-style file with coordinates for d4hjra_.
(The format of our PDB-style files is described here.)

Timeline for d4hjra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4hjrb_