Lineage for d1qkuc_ (1qku C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6345Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 6346Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 6347Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins)
  6. 6348Protein Estrogen receptor alpha [48519] (1 species)
  7. 6349Species Human (Homo sapiens) [TaxId:9606] [48520] (7 PDB entries)
  8. 6366Domain d1qkuc_: 1qku C: [19308]

Details for d1qkuc_

PDB Entry: 1qku (more details), 3.2 Å

PDB Description: wild type estrogen nuclear receptor ligand binding domain complexed with estradiol

SCOP Domain Sequences for d1qkuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkuc_ a.123.1.1 (C:) Estrogen receptor alpha {Human (Homo sapiens)}
nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
ldahrlh

SCOP Domain Coordinates for d1qkuc_:

Click to download the PDB-style file with coordinates for d1qkuc_.
(The format of our PDB-style files is described here.)

Timeline for d1qkuc_: