SCOPe 2.05: Domain d4ha0a_: 4ha0 A:

Lineage for d4ha0a_ (4ha0 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (22 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [189526] (16 PDB entries)

8. Domain d4ha0a_: 4ha0 A: [193078]
   automated match to d3ojga_
   complexed with fe, oh, zn; mutant

Details for d4ha0a_

PDB Entry: 4ha0, 1.9 Å

PDB Description: Structure of Geobacillus kaustophilus lactonase, mutant R230D with Zn2+

PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d4ha0a_:

Sequence; same for both SEQRES and ATOM records:

>d4ha0a_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafddfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfs

Timeline for d4ha0a_:

• d4ha0a_ first appeared in SCOPe 2.02
  
• d4ha0a_ appears in SCOPe 2.04
  
• d4ha0a_ appears in SCOPe 2.06
  
• d4ha0a_ appears in the current release, SCOPe 2.08