Lineage for d1qkub_ (1qku B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 50845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 50846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (14 proteins)
  6. 50853Protein Estrogen receptor alpha [48519] (1 species)
  7. 50854Species Human (Homo sapiens) [TaxId:9606] [48520] (7 PDB entries)
  8. 50870Domain d1qkub_: 1qku B: [19307]

Details for d1qkub_

PDB Entry: 1qku (more details), 3.2 Å

PDB Description: wild type estrogen nuclear receptor ligand binding domain complexed with estradiol

SCOP Domain Sequences for d1qkub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkub_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens)}
nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
ldahrlh

SCOP Domain Coordinates for d1qkub_:

Click to download the PDB-style file with coordinates for d1qkub_.
(The format of our PDB-style files is described here.)

Timeline for d1qkub_: