Lineage for d4gggb_ (4ggg B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1079364Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1079487Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1079516Protein automated matches [191027] (2 species)
    not a true protein
  7. 1079524Species Staphylococcus aureus [TaxId:158879] [193060] (1 PDB entry)
  8. 1079526Domain d4gggb_: 4ggg B: [193062]
    automated match to d1r1uc_
    complexed with cl, zn

Details for d4gggb_

PDB Entry: 4ggg (more details), 2 Å

PDB Description: crystal structure of v66a/l68v czra in the zn(ii)bound state.
PDB Compounds: (B:) repressor protein

SCOPe Domain Sequences for d4gggb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gggb_ a.4.5.5 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]}
ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksahv
vkakrqgqsmiyslddihvatmlkqaihhanhp

SCOPe Domain Coordinates for d4gggb_:

Click to download the PDB-style file with coordinates for d4gggb_.
(The format of our PDB-style files is described here.)

Timeline for d4gggb_: