SCOPe 2.07: Domain d4ggga_: 4ggg A:

Lineage for d4ggga_ (4ggg A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [191027] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [193060] (1 PDB entry)

8. Domain d4ggga_: 4ggg A: [193061]
   automated match to d1r1uc_
   complexed with cl, zn

Details for d4ggga_

PDB Entry: 4ggg, 2 Å

PDB Description: crystal structure of v66a/l68v czra in the zn(ii)bound state.

PDB Compounds: (A:) repressor protein

SCOPe Domain Sequences for d4ggga_:

Sequence; same for both SEQRES and ATOM records:

>d4ggga_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
dtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksahvvk
akrqgqsmiyslddihvatmlkqaihhanhpk

Timeline for d4ggga_:

• d4ggga_ first appeared in SCOPe 2.02
  
• d4ggga_ appears in SCOPe 2.06
  
• d4ggga_ appears in the current release, SCOPe 2.08