| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
| Protein automated matches [191027] (2 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158879] [193060] (1 PDB entry) |
| Domain d4ggga_: 4ggg A: [193061] automated match to d1r1uc_ complexed with cl, zn |
PDB Entry: 4ggg (more details), 2 Å
SCOPe Domain Sequences for d4ggga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggga_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
dtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksahvvk
akrqgqsmiyslddihvatmlkqaihhanhpk
Timeline for d4ggga_: