Lineage for d1qkua_ (1qku A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923341Protein Estrogen receptor alpha [48519] (1 species)
  7. 923342Species Human (Homo sapiens) [TaxId:9606] [48520] (57 PDB entries)
    Uniprot P03372 307-551
  8. 923455Domain d1qkua_: 1qku A: [19306]
    complex with estradiol
    complexed with est

Details for d1qkua_

PDB Entry: 1qku (more details), 3.2 Å

PDB Description: wild type estrogen nuclear receptor ligand binding domain complexed with estradiol
PDB Compounds: (A:) estradiol receptor

SCOPe Domain Sequences for d1qkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkua_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
lemldahrlh

SCOPe Domain Coordinates for d1qkua_:

Click to download the PDB-style file with coordinates for d1qkua_.
(The format of our PDB-style files is described here.)

Timeline for d1qkua_: