Lineage for d4fh1a_ (4fh1 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164143Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 2164161Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (5 PDB entries)
  8. 2164165Domain d4fh1a_: 4fh1 A: [193058]
    automated match to d2gmia1
    complexed with nhe

Details for d4fh1a_

PDB Entry: 4fh1 (more details), 2.61 Å

PDB Description: s. cerevisiae ubc13-n79a
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 13

SCOPe Domain Sequences for d4fh1a_:

Sequence, based on SEQRES records: (download)

>d4fh1a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy
pmeapkvrfltkiyhpaidrlgrisldvlktnwspalqirtvllsiqallaspnpndpla
ndvaedwikneqgakakarewtklyakkk

Sequence, based on observed residues (ATOM records): (download)

>d4fh1a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy
pmeapkvrfltkiyhpaidrlgrisldvlktnwspalqirtvllsiqallaspnpnndva
edwikneqgakakarewtklyakkk

SCOPe Domain Coordinates for d4fh1a_:

Click to download the PDB-style file with coordinates for d4fh1a_.
(The format of our PDB-style files is described here.)

Timeline for d4fh1a_: