Lineage for d4fjwd_ (4fjw D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1836183Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1836184Protein automated matches [190246] (49 species)
    not a true protein
  7. 1836535Species Mycobacterium tuberculosis [TaxId:83332] [187022] (7 PDB entries)
  8. 1836536Domain d4fjwd_: 4fjw D: [193056]
    automated match to d3q0jd_

Details for d4fjwd_

PDB Entry: 4fjw (more details), 2.2 Å

PDB Description: Crystal Structure of the apo form of the E131Q Mtb crotonase
PDB Compounds: (D:) Probable enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d4fjwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fjwd_ c.14.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsaka
faagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvli
aadtakfgqpqiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvv
paddlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqs
egmaafiekrapqfth

SCOPe Domain Coordinates for d4fjwd_:

Click to download the PDB-style file with coordinates for d4fjwd_.
(The format of our PDB-style files is described here.)

Timeline for d4fjwd_: