Lineage for d4et7a_ (4et7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774192Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 2774206Protein automated matches [190969] (1 species)
    not a true protein
  7. 2774207Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 2774229Domain d4et7a_: 4et7 A: [193051]
    automated match to d3gxua_

Details for d4et7a_

PDB Entry: 4et7 (more details), 2.6 Å

PDB Description: Crystal structure of Eph receptor 5
PDB Compounds: (A:) Ephrin type-A receptor 5

SCOPe Domain Sequences for d4et7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4et7a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevnlldsrtvmgdlgwiafpkngweeigevdenyapihtyqvckvmeqnqnnwlltswi
snegasrifielkftlrdcnslpgglgtcketfnmyyfesddqngrnikenqyikidtia
adesfteldlgdrvmklntevrdvgplskkgfylafqdvgacialvsvrvyyke

SCOPe Domain Coordinates for d4et7a_:

Click to download the PDB-style file with coordinates for d4et7a_.
(The format of our PDB-style files is described here.)

Timeline for d4et7a_: