SCOPe 2.08: Domain d4edbc_: 4edb C:

Lineage for d4edbc_ (4edb C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d4edbc_: 4edb C: [193048]
   Other proteins in same PDB: d4edbb_, d4edbd_, d4edbf_
   automated match to d1rvxa_

Details for d4edbc_

PDB Entry: 4edb, 2.5 Å

PDB Description: structures of monomeric hemagglutinin and its complex with an fab fragment of a neutralizing antibody that binds to h1 subtype influenza viruses: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4edbc_:

Sequence; same for both SEQRES and ATOM records:

>d4edbc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
ilgnpecelliskeswsyivekpnpengtcypghfadyeelreqlssvssferfemfpke
sswpnhtvtgvsascshngkssfyknllwltgknglypnlsksyannkekevlvlwgvhh
ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdtii
feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
ecpkyvrsaklrmvtglrnipsi

Timeline for d4edbc_:

• d4edbc_ first appeared in SCOPe 2.02
  
• d4edbc_ appears in SCOPe 2.07