Lineage for d4edbe_ (4edb E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385289Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)
  8. 2385588Domain d4edbe_: 4edb E: [193047]
    Other proteins in same PDB: d4edbb_, d4edbd_, d4edbf_
    automated match to d1rvxa_

Details for d4edbe_

PDB Entry: 4edb (more details), 2.5 Å

PDB Description: structures of monomeric hemagglutinin and its complex with an fab fragment of a neutralizing antibody that binds to h1 subtype influenza viruses: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4edbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4edbe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
ilgnpecelliskeswsyivekpnpengtcypghfadyeelreqlssvssferfemfpke
sswpnhtvtgvsascshngkssfyknllwltgknglypnlsksyannkekevlvlwgvhh
ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdtii
feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
ecpkyvrsaklrmvtglrnipsi

SCOPe Domain Coordinates for d4edbe_:

Click to download the PDB-style file with coordinates for d4edbe_.
(The format of our PDB-style files is described here.)

Timeline for d4edbe_: