Lineage for d4bgwa_ (4bgw A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385864Species Influenza virus [TaxId:644788] [193029] (6 PDB entries)
  8. 2385866Domain d4bgwa_: 4bgw A: [193043]
    Other proteins in same PDB: d4bgwb_
    automated match to d2fk0a1
    complexed with epe, nag

Details for d4bgwa_

PDB Entry: 4bgw (more details), 2.48 Å

PDB Description: crystal structure of h5 (vn1194) influenza haemagglutinin
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgwa_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4bgwa_:

Click to download the PDB-style file with coordinates for d4bgwa_.
(The format of our PDB-style files is described here.)

Timeline for d4bgwa_: