![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (24 species) not a true protein |
![]() | Species Influenza a virus [TaxId:375457] [193032] (1 PDB entry) |
![]() | Domain d4bh1c_: 4bh1 C: [193042] Other proteins in same PDB: d4bh1b_, d4bh1d_, d4bh1f_ automated match to d2fk0a1 complexed with nag, po4 |
PDB Entry: 4bh1 (more details), 2.15 Å
SCOPe Domain Sequences for d4bh1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bh1c_ b.19.1.2 (C:) automated matches {Influenza a virus [TaxId: 375457]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks swsdheasagvssacpyqgrssffrnvvwlikkdnayptikrsynntnqedllvlwgihh pndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain fesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltig ecpkyvkssrlvlatglrn
Timeline for d4bh1c_: