Lineage for d4bh1e_ (4bh1 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1306050Protein automated matches [190291] (11 species)
    not a true protein
  7. 1306095Species Influenza a virus [TaxId:375457] [193032] (1 PDB entry)
  8. 1306098Domain d4bh1e_: 4bh1 E: [193041]
    automated match to d2fk0a1
    complexed with nag, po4

Details for d4bh1e_

PDB Entry: 4bh1 (more details), 2.15 Å

PDB Description: h5 (tyty) influenza virus haemagglutinin in complex with avian receptor analogue 3'-sln
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4bh1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh1e_ b.19.1.2 (E:) automated matches {Influenza a virus [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasagvssacpyqgrssffrnvvwlikkdnayptikrsynntnqedllvlwgihh
pndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltig
ecpkyvkssrlvlatglrn

SCOPe Domain Coordinates for d4bh1e_:

Click to download the PDB-style file with coordinates for d4bh1e_.
(The format of our PDB-style files is described here.)

Timeline for d4bh1e_: