Lineage for d4bgya_ (4bgy A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (25 species)
    not a true protein
  7. 2040877Species Influenza virus [TaxId:644788] [193029] (6 PDB entries)
  8. 2040880Domain d4bgya_: 4bgy A: [193038]
    Other proteins in same PDB: d4bgyb_
    automated match to d2fk0a1
    complexed with epe

Details for d4bgya_

PDB Entry: 4bgy (more details), 2.68 Å

PDB Description: H5 (VN1194) Influenza Virus Haemagglutinin in Complex with Avian Receptor Analogue 3'-SLN
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bgya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgya_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4bgya_:

Click to download the PDB-style file with coordinates for d4bgya_.
(The format of our PDB-style files is described here.)

Timeline for d4bgya_: