Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (24 species) not a true protein |
Species Influenza virus [TaxId:284218] [193030] (3 PDB entries) |
Domain d4bh3a_: 4bh3 A: [193037] Other proteins in same PDB: d4bh3b_ automated match to d3gbma_ complexed with epe, nag; mutant |
PDB Entry: 4bh3 (more details), 2 Å
SCOPe Domain Sequences for d4bh3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bh3a_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 284218]} dpdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsva gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt igecpkyvksnrlvlaiglrnspq
Timeline for d4bh3a_: