Lineage for d4bh3a_ (4bh3 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778665Species Influenza virus [TaxId:284218] [193030] (3 PDB entries)
  8. 1778667Domain d4bh3a_: 4bh3 A: [193037]
    Other proteins in same PDB: d4bh3b_
    automated match to d3gbma_
    complexed with epe, nag; mutant

Details for d4bh3a_

PDB Entry: 4bh3 (more details), 2 Å

PDB Description: haemagglutinin from a transmissible mutant h5 influenza virus in complex with human receptor analogue 6'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh3a_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 284218]}
dpdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsva
gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi
hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda
infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
igecpkyvksnrlvlaiglrnspq

SCOPe Domain Coordinates for d4bh3a_:

Click to download the PDB-style file with coordinates for d4bh3a_.
(The format of our PDB-style files is described here.)

Timeline for d4bh3a_: