![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (3 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (11 species) not a true protein |
![]() | Species Influenza virus [TaxId:284218] [193030] (2 PDB entries) |
![]() | Domain d4bh2a_: 4bh2 A: [193036] automated match to d3gbma_ complexed with epe, nag; mutant |
PDB Entry: 4bh2 (more details), 2.12 Å
SCOPe Domain Sequences for d4bh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bh2a_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 284218]} dpdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsva gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt igecpkyvksnrlvlaiglrnspq
Timeline for d4bh2a_: