Lineage for d4bh4a_ (4bh4 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117012Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1117013Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 1117058Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1117236Protein automated matches [190291] (11 species)
    not a true protein
  7. 1117275Species Influenza virus [TaxId:284218] [193030] (2 PDB entries)
  8. 1117276Domain d4bh4a_: 4bh4 A: [193034]
    automated match to d3gbma_
    complexed with epe, nag; mutant

Details for d4bh4a_

PDB Entry: 4bh4 (more details), 1.9 Å

PDB Description: haemagglutinin from a transmissible mutant h5 influenza virus in complex with avian receptor analogue 3'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh4a_ b.19.1.2 (A:) automated matches {Influenza virus [TaxId: 284218]}
dpdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsva
gwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiip
ksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgi
hhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnda
infesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplt
igecpkyvksnrlvlaiglrnspq

SCOPe Domain Coordinates for d4bh4a_:

Click to download the PDB-style file with coordinates for d4bh4a_.
(The format of our PDB-style files is described here.)

Timeline for d4bh4a_: