Lineage for d4bh4a1 (4bh4 A:1-322)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776179Species Influenza virus [TaxId:284218] [193030] (3 PDB entries)
  8. 2776180Domain d4bh4a1: 4bh4 A:1-322 [193034]
    Other proteins in same PDB: d4bh4a2, d4bh4b_
    automated match to d3gbma_
    complexed with epe, nag; mutant

Details for d4bh4a1

PDB Entry: 4bh4 (more details), 1.9 Å

PDB Description: haemagglutinin from a transmissible mutant h5 influenza virus in complex with avian receptor analogue 3'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bh4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bh4a1 b.19.1.2 (A:1-322) automated matches {Influenza virus [TaxId: 284218]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlaiglrnspq

SCOPe Domain Coordinates for d4bh4a1:

Click to download the PDB-style file with coordinates for d4bh4a1.
(The format of our PDB-style files is described here.)

Timeline for d4bh4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bh4a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4bh4b_