SCOPe 2.08: Domain d4edac_: 4eda C:

Lineage for d4edac_ (4eda C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d4edac_: 4eda C: [193028]
   Other proteins in same PDB: d4edab_
   automated match to d3m6sa_
   complexed with nag

Details for d4edac_

PDB Entry: 4eda, 2.7 Å

PDB Description: structures of monomeric hemagglutinin and its complex with an fab fragment of a neutralizing antibody that binds to h1 subtype influenza viruses: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4edac_:

Sequence; same for both SEQRES and ATOM records:

>d4edac_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
nstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagwilgnpecesl
stasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpktsswpnhdsnk
gvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhpstsadqqs
lyqnadayvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdkitfeatgnlvv
pryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkcpkyvkst
klrlatglrnv

Timeline for d4edac_:

• d4edac_ first appeared in SCOPe 2.02
  
• d4edac_ appears in SCOPe 2.07