Lineage for d4bfzb_ (4bfz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872627Species Mycobacterium tuberculosis [TaxId:83332] [187746] (23 PDB entries)
  8. 2872634Domain d4bfzb_: 4bfz B: [193023]
    automated match to d2gesa_
    complexed with po4, zvz

Details for d4bfzb_

PDB Entry: 4bfz (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis pank in complex with a biaryl inhibitory compound (2b) and phosphate
PDB Compounds: (B:) pantothenate kinase

SCOPe Domain Sequences for d4bfzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bfzb_ c.37.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa
rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv
ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip
gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtta
fadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinr
lrlrkl

SCOPe Domain Coordinates for d4bfzb_:

Click to download the PDB-style file with coordinates for d4bfzb_.
(The format of our PDB-style files is described here.)

Timeline for d4bfzb_: