Lineage for d4bfua_ (4bfu A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850183Species Mycobacterium tuberculosis [TaxId:83332] [187746] (21 PDB entries)
  8. 1850196Domain d4bfua_: 4bfu A: [193020]
    automated match to d2gesa_
    complexed with po4, zvu

Details for d4bfua_

PDB Entry: 4bfu (more details), 2.28 Å

PDB Description: crystal structure of mycobacterium tuberculosis pank in complex with a triazole inhibitory compound (1c) and phosphate
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d4bfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bfua_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa
rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv
ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip
gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtta
fadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinr
lrlrkl

SCOPe Domain Coordinates for d4bfua_:

Click to download the PDB-style file with coordinates for d4bfua_.
(The format of our PDB-style files is described here.)

Timeline for d4bfua_: