Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187746] (23 PDB entries) |
Domain d4bfwa_: 4bfw A: [193019] automated match to d2gesa_ complexed with po4, zvw |
PDB Entry: 4bfw (more details), 2.27 Å
SCOPe Domain Sequences for d4bfwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bfwa_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} pspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqvaa rqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdlv ttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiip gaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtta fadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinr lrlrkl
Timeline for d4bfwa_: