SCOPe 2.04: Domain d4apz7_: 4apz 7:

Lineage for d4apz7_ (4apz 7:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (11 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries)

8. Domain d4apz7_: 4apz 7: [193009]
   automated match to d2xcea_
   complexed with dur, mg, po4, pop

Details for d4apz7_

PDB Entry: 4apz, 2.01 Å

PDB Description: Structure of B. subtilis genomic dUTPase YncF in complex with dU, PPi and Mg in P1

PDB Compounds: (7:) probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf

SCOPe Domain Sequences for d4apz7_:

Sequence; same for both SEQRES and ATOM records:

>d4apz7_ b.85.4.0 (7:) automated matches {Bacillus subtilis [TaxId: 1423]}
mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
elvevehlgnedrgglgstgtk

Timeline for d4apz7_:

• d4apz7_ first appeared in SCOPe 2.02
  
• d4apz7_ appears in SCOPe 2.03
  
• d4apz7_ appears in SCOPe 2.05
  
• d4apz7_ appears in the current release, SCOPe 2.08