Lineage for d4aoyb_ (4aoy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (16 species)
    not a true protein
  7. 2138999Species Clostridium thermocellum [TaxId:1515] [192994] (2 PDB entries)
  8. 2139001Domain d4aoyb_: 4aoy B: [193001]
    automated match to d2uxqa_

Details for d4aoyb_

PDB Entry: 4aoy (more details), 2.35 Å

PDB Description: Open CtIDH. The complex structures of Isocitrate dehydrogenase from Clostridium thermocellum and Desulfotalea psychrophila, support a new active site locking mechanism
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d4aoyb_:

Sequence, based on SEQRES records: (download)

>d4aoyb_ c.77.1.0 (B:) automated matches {Clostridium thermocellum [TaxId: 1515]}
kikmkvplvemdgdemtriiwrlikenllepyielnteyydlglenrdktedqvtidaar
aiqkygvgvkcatitpnaqrveeynlkkmwkspngtiraildgtvfrapivvnsikpfvk
gwkkpisiarhaygdvyknveyyvpsagkaelvftsengevsrqtihefdgpgvimgmhn
tdksirsfaracfnyaldmnqdlwfstkdtisktydhrfkdifqeiyeneykekfeaknl
qyfytliddavariirseggmvwacknydgdvmsdmvasafgslammtsvlvspdgkyef
eaahgtvtrhyykhlkgeetstnsmatifawtgalkkrgeldgikelvdfatkleqasvq
tiengvmtkdlaslsevpekkivntedflkeirktfegm

Sequence, based on observed residues (ATOM records): (download)

>d4aoyb_ c.77.1.0 (B:) automated matches {Clostridium thermocellum [TaxId: 1515]}
kikmkvplvemdgdemtriiwrlikenllepyielnteyydlglenrdktedqvtidaar
aiqkygvgvkcatitpnaqrveeynlkkmwkspngtiraildgtvfrapivvnsikpfvk
gwkkpisiarhknveyyvpsagkaelvftsengevsrqtihefdgpgvimgmhntdksir
sfaracfnyaldmnqdlwfstktydhrfkdifqeiyeneykekfeaknlqyfytliddav
ariirseggmvwacknydgdvmsdmvasafgslammtsvlvspdgkyefeaatstnsmat
ifawtgalkkrgeldgikelvdfatkleqasvqtiengvmtkdlaslsevpekkivnted
flkeirktfegm

SCOPe Domain Coordinates for d4aoyb_:

Click to download the PDB-style file with coordinates for d4aoyb_.
(The format of our PDB-style files is described here.)

Timeline for d4aoyb_: