SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4aoyc_ (4aoy C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (14 species)
    not a true protein
  7. 2138999Species Clostridium thermocellum [TaxId:1515] [192994] (2 PDB entries)
  8. 2139002Domain d4aoyc_: 4aoy C: [192999]
    automated match to d2uxqa_

Details for d4aoyc_

PDB Entry: 4aoy (more details), 2.35 Å

PDB Description: Open CtIDH. The complex structures of Isocitrate dehydrogenase from Clostridium thermocellum and Desulfotalea psychrophila, support a new active site locking mechanism
PDB Compounds: (C:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d4aoyc_:

Sequence, based on SEQRES records: (download)

>d4aoyc_ c.77.1.0 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]}
skikmkvplvemdgdemtriiwrlikenllepyielnteyydlglenrdktedqvtidaa
raiqkygvgvkcatitpnaqrveeynlkkmwkspngtiraildgtvfrapivvnsikpfv
kgwkkpisiarhaygdvyknveyyvpsagkaelvftsengevsrqtihefdgpgvimgmh
ntdksirsfaracfnyaldmnqdlwfstkdtisktydhrfkdifqeiyeneykekfeakn
lqyfytliddavariirseggmvwacknydgdvmsdmvasafgslammtsvlvspdgkye
feaahgtvtrhyykhlkgeetstnsmatifawtgalkkrgeldgikelvdfatkleqasv
qtiengvmtkdlaslsevpekkivntedflkeirktfegm

Sequence, based on observed residues (ATOM records): (download)

>d4aoyc_ c.77.1.0 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]}
skikmkvplvemdgdemtriiwrlikenllepyielnteyydlglenrdktedqvtidaa
raiqkygvgvkcatitpnaqrveeynlkkmwkspngtiraildgtvfrapivvnsikpfv
kgwkkpisiarhnveyyvpsagkaelvftsengevsrqtihefdgpgvimgmhntdksir
sfaracfnyaldmnqdlwfstkdtisktydhrfkdifqeiyeneykekfeaknlqyfytl
iddavariirseggmvwackndvmsdmvasafgslammtsvlvspdgkyefeaansmati
fawtgalkkrgeldgikelvdfatkleqasvqtiengvmtkdlaslsevpekkivntedf
lkeirktfegm

SCOPe Domain Coordinates for d4aoyc_:

Click to download the PDB-style file with coordinates for d4aoyc_.
(The format of our PDB-style files is described here.)

Timeline for d4aoyc_: