SCOPe 2.05: Domain d3t2va_: 3t2v A:

Lineage for d3t2va_ (3t2v A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein automated matches [190549] (4 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (32 PDB entries)

8. Domain d3t2va_: 3t2v A: [192984]
   automated match to d3ng4a_
   complexed with gol, kkj, tla

Details for d3t2va_

PDB Entry: 3t2v, 2.51 Å

PDB Description: Crystal structure of the complex of peptidoglycan recognition protein-short (CPGRP-S) with mycolic acid at 2.5 A resolution

PDB Compounds: (A:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d3t2va_:

Sequence; same for both SEQRES and ATOM records:

>d3t2va_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

Timeline for d3t2va_:

• d3t2va_ first appeared in SCOPe 2.02
  
• d3t2va_ appears in SCOPe 2.04
  
• d3t2va_ appears in SCOPe 2.06
  
• d3t2va_ appears in the current release, SCOPe 2.08